DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6508 and Cym

DIOPT Version :9

Sequence 1:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_001104613.1 Gene:Cym / 229697 MGIID:2684977 Length:379 Species:Mus musculus


Alignment Length:389 Identity:141/389 - (36%)
Similarity:222/389 - (57%) Gaps:29/389 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FLLLLDHSMGQLRRTPITR-QINQNKTHANVKAEKILLAAKYFLVDRQ---SSQTTQV------- 65
            |:||| .::...:...:|| .:::.|:..|...|:.||  :.||..:|   |.:.:::       
Mouse     4 FVLLL-AALAISQSHVVTRIPLHKGKSLRNTLKEQGLL--EDFLSRQQYEFSEKNSRIGVVASEP 65

  Fly    66 LANGFNLEYTIRLCIGTPPQCFNLQFDTGSSDLWVPSVKCSSTNEACQKHNKYNSSASSSHVEDG 130
            |.|..:.||...:.||||||.|.:.||||||:||||||.|:|  :.|:.|::::.|.|.:.....
Mouse    66 LINYLDSEYFGTIYIGTPPQEFTVVFDTGSSELWVPSVYCNS--KVCRNHHRFDPSKSITFQNLS 128

  Fly   131 KGFSIQYGSGSLSGFLSTDTVDIDGMVIRNQTFAEAIDEPGSAFVNTIFDGIIGMAFASISGGVT 195
            |...:|||:|.:.|||:.|||.:..:|:.:||...:..|||..|..:.||||:|:|:.:.:...:
Mouse   129 KPLFVQYGTGRMEGFLAYDTVTVSDIVVSHQTVGLSTQEPGDIFTYSPFDGILGLAYPTFASKYS 193

  Fly   196 TP-FDNIIRQGLVKHPVFSVYLRRDGTSQSGGEVIWGGIDRSIYRGCINYVPVSMPAYWQFTANS 259
            .| |||::.:.||...:||||:.|   ::.|..:..|.||:|.:.|.:::|||::..|||||.:.
Mouse   194 VPIFDNMMNRHLVAQDLFSVYMSR---NEQGSMLTLGAIDQSYFIGSLHWVPVTVQGYWQFTVDR 255

  Fly   260 VKIEG-ILLC-NGCQAIADTGTSLIAVPLRAYKAINKVLNATDAGDGEAFVDCSSLCRLPNVNLN 322
            :.|.| ::.| .||.|:.||||:|:..|.|....|.:|:.|....:.:..:||..|..:|.|...
Mouse   256 ITINGEVVACQGGCPAVLDTGTALLTGPGRDILNIQQVIGAVQGHNDQFDIDCWRLDIMPTVVFE 320

  Fly   323 IGGTTYTLTPKDYIYKVQADNNQTLCLSGFTYLQGNLLWILGDIFLGKVYTVFDVGKERIGFAK 386
            |.|..:.|.|..|..:||.     .|.|||.  ||:.:|||||:|:.:.|:|||....|:|.||
Mouse   321 IHGREFPLPPYAYTNQVQG-----FCSSGFK--QGSHMWILGDVFIREFYSVFDRANNRVGLAK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:299705 123/320 (38%)
Asp 73..387 CDD:278455 124/317 (39%)
CymNP_001104613.1 A1_Propeptide 19..44 CDD:285240 7/26 (27%)
pepsin_retropepsin_like 64..377 CDD:299705 124/324 (38%)
Asp 73..378 CDD:278455 124/317 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841604
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.