DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6508 and asp-4

DIOPT Version :9

Sequence 1:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_510191.1 Gene:asp-4 / 181444 WormBaseID:WBGene00000217 Length:444 Species:Caenorhabditis elegans


Alignment Length:332 Identity:149/332 - (44%)
Similarity:207/332 - (62%) Gaps:9/332 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QVLANGFNLEYTIRLCIGTPPQCFNLQFDTGSSDLWVPSVKCSSTNEACQKHNKYNSSASSSHVE 128
            ::|.|..:.:|...:.||||.|.|.:.||||||:||:||.||...:.||..|::|:|.:||::.|
 Worm    84 ELLRNYMDAQYFGTISIGTPAQNFTVIFDTGSSNLWIPSKKCPFYDIACMLHHRYDSKSSSTYKE 148

  Fly   129 DGKGFSIQYGSGSLSGFLSTDTVDIDGMVIRNQTFAEAIDEPGSAFVNTIFDGIIGMAFASISG- 192
            ||:..:||||:||:.||:|.|:|.:.|:...:|.||||..|||..||...||||:|||:..|:. 
 Worm   149 DGRKMAIQYGTGSMKGFISKDSVCVAGVCAEDQPFAEATSEPGITFVAAKFDGILGMAYPEIAVL 213

  Fly   193 GVTTPFDNIIRQGLVKHPVFSVYLRRDGTSQSGGEVIWGGIDRSIYRGCINYVPVSMPAYWQFTA 257
            ||...|:.:..|..|...:||.:|.|:..|:.|||:.:||||...|...|.||||:...||||..
 Worm   214 GVQPVFNTLFEQKKVPSNLFSFWLNRNPDSEIGGEITFGGIDSRRYVEPITYVPVTRKGYWQFKM 278

  Fly   258 NSVKIEGILLC-NGCQAIADTGTSLIAVPLRAYKAINKVLNATDAGDGEAFVDCSSLCRLPNVNL 321
            :.|...|:|.| |||||||||||||||.|....:||...:.|.....||..:.|..:..||.|:.
 Worm   279 DKVVGSGVLGCSNGCQAIADTGTSLIAGPKAQIEAIQNFIGAEPLIKGEYMISCDKVPTLPPVSF 343

  Fly   322 NIGGTTYTLTPKDYIYKVQADNNQTLCLSGFTYLQ-----GNLLWILGDIFLGKVYTVFDVGKER 381
            .|||..::|..:||:.|| :...:|:|||||..:.     |. ||||||:|:|:.|:|||..:.|
 Worm   344 VIGGQEFSLKGEDYVLKV-SQGGKTICLSGFMGIDLPERVGE-LWILGDVFIGRYYSVFDFDQNR 406

  Fly   382 IGFAKLK 388
            :|||:.|
 Worm   407 VGFAQAK 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:299705 146/324 (45%)
Asp 73..387 CDD:278455 146/320 (46%)
asp-4NP_510191.1 pepsin_retropepsin_like 88..411 CDD:386101 146/324 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.