DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6508 and asp-3

DIOPT Version :9

Sequence 1:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_509142.2 Gene:asp-3 / 180947 WormBaseID:WBGene00000216 Length:398 Species:Caenorhabditis elegans


Alignment Length:353 Identity:133/353 - (37%)
Similarity:190/353 - (53%) Gaps:17/353 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LAAKY---FLVDRQSSQTTQVLANGFNLEYTIRLCIGTPPQCFNLQFDTGSSDLWVPSVKCSSTN 109
            |.|||   ::.::.:  ..:.|::..|.:|...:.||||||.|.:.||||||:||||...|...:
 Worm    42 LKAKYVPGYIPNKDA--FNEGLSDYSNAQYYGPVTIGTPPQNFQVLFDTGSSNLWVPCANCPFGD 104

  Fly   110 EACQKHNKYNSSASSSHVEDGKGFSIQYGSGSLSGFLSTDTV----DIDGMVIRNQTFAEAIDEP 170
            .||:.||:::...|||....|..|.||||:||:.|.:..|.|    |......:||..|.|..||
 Worm   105 IACRMHNRFDCKKSSSCTATGASFEIQYGTGSMKGTVDNDVVCFGHDTTYCTDKNQGLACATSEP 169

  Fly   171 GSAFVNTIFDGIIGMAFASIS-GGVTTPFDNII-RQGLVKHPVFSVYLRRDGTS-QSGGEVIWGG 232
            |..||...||||.||.:.:|| ..::.|.|.|. ...:.|:.:|:.:|.||... .:|||:....
 Worm   170 GITFVAAKFDGIFGMGWDTISVNKISQPMDQIFANSAICKNQLFAFWLSRDANDITNGGEITLCD 234

  Fly   233 IDRSIYRGCINYVPVSMPAYWQFTANSVKIEGILLCNG-CQAIADTGTSLIAVPLRAYKAINKVL 296
            .|.:.|.|.|.:.|:....||:....||.|:|....:| ..:|.||||||:..|....|.|...:
 Worm   235 TDPNHYVGNIAWEPLVSEDYWRIKLASVVIDGTTYTSGPIDSIVDTGTSLLTGPTDVIKKIQHKI 299

  Fly   297 NATDAGDGEAFVDCSSLCRLPNVNLNIGGTTYTLTPKDYIYKVQADNNQTLCLSGFTYLQ----G 357
            ......:||..|:||.:..|||:..|:||..:.|..||||.::...|..:.|||||..:.    .
 Worm   300 GGIPLFNGEYEVECSKIPSLPNITFNLGGQNFDLQGKDYILQMSNGNGGSTCLSGFMGMDIPAPA 364

  Fly   358 NLLWILGDIFLGKVYTVFDVGKERIGFA 385
            ..||||||:|:|:.|:|||.|.:|:|||
 Worm   365 GPLWILGDVFIGRFYSVFDHGNKRVGFA 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:299705 128/330 (39%)
Asp 73..387 CDD:278455 127/325 (39%)
asp-3NP_509142.2 pepsin_retropepsin_like 59..393 CDD:299705 129/334 (39%)
Asp 68..393 CDD:278455 127/325 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.