DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6508 and asp-6

DIOPT Version :9

Sequence 1:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_505133.1 Gene:asp-6 / 179209 WormBaseID:WBGene00000219 Length:389 Species:Caenorhabditis elegans


Alignment Length:330 Identity:119/330 - (36%)
Similarity:178/330 - (53%) Gaps:21/330 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NGF-NLEYTIRLCIGTPPQCFNLQFDTGSSDLWVPSVKCSSTNEACQKHNKYNSSASSSHVEDGK 131
            |.| :.||...:.||||.|.|.:..|||||:||:|...| .||  |:..:|::|:|||:.|::||
 Worm    64 NDFGDFEYLGNITIGTPDQGFIVVLDTGSSNLWIPGPTC-KTN--CKTKSKFDSTASSTFVKNGK 125

  Fly   132 GFSIQYGSGSLSGFLSTDTVDIDG-----MVIRNQTFAEAIDEPGSAFVNTIFDGIIGMAFASIS 191
            .::||||||..:|.|..|||....     :.:...||..| .:..:.|.|...|||:|:||.|::
 Worm   126 SWTIQYGSGDAAGILGQDTVRFGAKGDSQLSVPTTTFGIA-SKISADFKNDATDGILGLAFTSLA 189

  Fly   192 -GGVTTPFDNIIRQGLVKHPVFSVYLRRDGTSQS--GGEVIWGGIDRSIYRGCINYVPVSMPAYW 253
             .||..|..|.|.||::..|:|||:|...|.:.:  ||...:|.||.:.....:.|.|:|...|:
 Worm   190 VDGVVPPLINAINQGILDQPLFSVWLEHRGAANNVGGGVFTYGAIDTTNCGALVAYQPLSSATYY 254

  Fly   254 QFTANSVKIEGILLCNGCQAIADTGTSLIAVPLRAYKAINKVLNAT-DAGDGEAFVDCSSLCRLP 317
            ||.|...|:...........|:|||||.:..|......:.|...|| |..:...|:||::  :..
 Worm   255 QFKAAGFKLGSYSNTKTVDVISDTGTSFLGGPQSVVDGLAKAAGATYDDFNEVYFIDCAA--QPG 317

  Fly   318 NVNLNIGGTTYTLTPKDYIYKVQADNNQTLCLSGFTYLQGNL--LWILGDIFLGKVYTVFDVGKE 380
            .:::.||..||::.|.:||  |.|.|.|.| .:.|.:..|..  .|||||.|:.:...::|:|.:
 Worm   318 TLDITIGTNTYSIQPVNYI--VDAGNGQCL-FAAFPFDFGGFGPSWILGDPFIRQYCNIYDIGNK 379

  Fly   381 RIGFA 385
            |:|||
 Worm   380 RMGFA 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:299705 119/330 (36%)
Asp 73..387 CDD:278455 117/324 (36%)
asp-6NP_505133.1 Asp 70..385 CDD:278455 117/324 (36%)
pepsin_like 71..385 CDD:133138 116/323 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.