DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6508 and asp-8

DIOPT Version :9

Sequence 1:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_503825.2 Gene:asp-8 / 178750 WormBaseID:WBGene00019105 Length:386 Species:Caenorhabditis elegans


Alignment Length:362 Identity:112/362 - (30%)
Similarity:174/362 - (48%) Gaps:31/362 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EKILLAAKYFLVDRQSSQTTQVLANG-------FNLEYTIRLCIGTPPQCFNLQFDTGSSDLWVP 101
            |:::...:|    .|.....|.|:.|       |:..||..:.||||.|.|.:.|||.||:|||.
 Worm    32 EQLIREGRY----GQELARIQQLSTGNVSFFDHFDEYYTAGVRIGTPAQHFQVAFDTTSSNLWVF 92

  Fly   102 SVKCSSTNEAC-----QKHNKYNSSASSSHVEDGKGFSIQYGSGSLSGFLSTDTVDIDGMVIRNQ 161
            .|:|.|.|  |     ::..:||.:|||:.|.....|::.|..|.:||.:..||....|..|::|
 Worm    93 GVECRSQN--CHGGRGRRDREYNRTASSTFVAGTSSFNLPYDGGHVSGNVGKDTAQFAGFTIQSQ 155

  Fly   162 TFAEAIDEPGSAFVNTIFDGIIGMAF-ASISGGVTTPFDNIIRQGLVKHPVFSVYLRR----DGT 221
            .|  .|....:......|||::|:.: |:...|.:|...|::.|  :...:|:.|..:    :||
 Worm   156 DF--GIGTAATRLFGETFDGVLGLGWPATALNGTSTTMQNLLPQ--LDQKLFTTYFTKSNMHNGT 216

  Fly   222 SQSGGEVIWGGIDRSIYRGCINYVPVSMPAYWQFTANSVKIEGILLCNGCQAIADTGTSLIAVPL 286
              :||::::|.||.:..:..:||||::..::|.::.:...|...........|.||.:....||.
 Worm   217 --AGGDIMFGAIDTTHCQSQVNYVPLAYNSFWSYSVDGFSIGTYSRTQTETTIPDTSSGWTGVPN 279

  Fly   287 RAYKAINKVLNATDAGDGEAF-VDCSSLCRLPNVNLNIGGTTYTLTPKDYIYKVQADNNQ-TLCL 349
            .....|.|...||...:.:|: :.|||...||::...|||.:|.:...:|:..:...|.| .|.|
 Worm   280 VVLAGIVKATGATYDWNHQAYTLPCSSTATLPDMVFTIGGNSYNVRAVEYVVNLNLPNGQCALSL 344

  Fly   350 SGFTYLQGNLLWILGDIFLGKVYTVFDVGKERIGFAK 386
            .|....|....|||||.||.....|||.|..|||.||
 Worm   345 FGTAASQSGPAWILGDNFLRSYCHVFDFGNSRIGLAK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:299705 105/336 (31%)
Asp 73..387 CDD:278455 105/326 (32%)
asp-8NP_503825.2 pepsin_like 65..381 CDD:133138 103/323 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162002
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.