DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6508 and LOC101735147

DIOPT Version :9

Sequence 1:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster
Sequence 2:XP_031756605.1 Gene:LOC101735147 / 101735147 -ID:- Length:337 Species:Xenopus tropicalis


Alignment Length:323 Identity:150/323 - (46%)
Similarity:203/323 - (62%) Gaps:8/323 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EYTIRLCIGTPPQCFNLQFDTGSSDLWVPSVKCSSTNEACQKHNKYNSSASSSHVEDGKGFSIQY 137
            :|...:.:||.||.|.:.||||||:||||||.||..:.||..|:||:||.||::|::|..|:|||
 Frog    16 QYYGEIGLGTAPQNFTVVFDTGSSNLWVPSVHCSMLDIACWMHHKYDSSKSSTYVKNGTAFAIQY 80

  Fly   138 GSGSLSGFLSTDTVDIDGMVIRNQTFAEAIDEPGSAFVNTIFDGIIGMAFASIS-GGVTTPFDNI 201
            |:|||||:||.|||.|..:.::.|.|.||:.:||..||...||||:|||:..|| .|....||||
 Frog    81 GTGSLSGYLSKDTVTIGNLAVKGQIFGEAVKQPGVTFVAAKFDGILGMAYPVISVDGAPPVFDNI 145

  Fly   202 IRQGLVKHPVFSVYLRRDGTSQSGGEVIWGGIDRSIYRGCINYVPVSMPAYWQFTANSVKI-EGI 265
            :.|.||:..:||.||.|:..:|.|||::.||.|...|.|..:|:.|:..||||...:.:.: :.:
 Frog   146 MAQKLVESNIFSFYLNRNPDTQPGGELLLGGTDPKYYTGDFHYLSVTRKAYWQIHMDQLGVGDQL 210

  Fly   266 LLC-NGCQAIADTGTSLIAVPLRAYKAINKVLNATDAGDGEAFVDCSSLCRLPNVNLNIGGTTYT 329
            .|| .||:.|.|||||||..||....|:.|.:.|.....|:..|.|..:..||.::|.:||..||
 Frog   211 TLCKGGCEVIVDTGTSLITGPLEEVTALQKAIGAVPLIQGQYMVQCDKVPTLPVISLTLGGQVYT 275

  Fly   330 LTPKDYIYKVQADNNQTLCLSGFTYLQ----GNLLWILGDIFLGKVYTVFDVGKERIGFAKLK 388
            ||.:.||.|| :....|:|||||..|.    ...||||||:|:|:.|:|||....|:||||.|
 Frog   276 LTGEQYIMKV-SQLGSTICLSGFMGLNIPPPAGPLWILGDVFIGQYYSVFDRANNRVGFAKAK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:299705 147/319 (46%)
Asp 73..387 CDD:278455 148/320 (46%)
LOC101735147XP_031756605.1 Cathepsin_D2 12..335 CDD:133157 147/319 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.