DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6508 and LOC100493461

DIOPT Version :9

Sequence 1:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster
Sequence 2:XP_002938556.2 Gene:LOC100493461 / 100493461 -ID:- Length:402 Species:Xenopus tropicalis


Alignment Length:332 Identity:145/332 - (43%)
Similarity:203/332 - (61%) Gaps:10/332 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 TTQVLANGFNLEYTIRLCIGTPPQCFNLQFDTGSSDLWVPSVKCSSTNEACQKHNKYNSSASSSH 126
            ||:.|.:..|.:|...:.:|||||.|::.||||||:.||||..|.|  ||||.|.::.|..|:|:
 Frog    69 TTEYLVDYMNAQYYGEISVGTPPQNFSVVFDTGSSNFWVPSSYCLS--EACQVHERFKSFESTSY 131

  Fly   127 VEDGKGFSIQYGSGSLSGFLSTDTVDIDGMVIRNQTFAEAIDEPGSAFVNTIFDGIIGMAFASIS 191
            ...|:.|||.||:|.|.|....||:.|..|.|..|.|.|:|.|||..||...|||::|:.:.|::
 Frog   132 EHGGRPFSIHYGTGQLVGVTGRDTLRISNMSIEGQDFGESILEPGRTFVLAQFDGVLGLGYPSLA 196

  Fly   192 -GGVTTPFDNIIRQGLVKHPVFSVYLRRDGTSQSGGEVIWGGIDRSIYRGCINYVPVSMPAYWQF 255
             .|....||.|:.|.||:..:||.:|.||..|:.|||:|:||||.|:|:|.|:::|::...|||.
 Frog   197 VAGAVPVFDRIVNQKLVEQQLFSFHLNRDYDSEYGGELIFGGIDHSLYKGQIHWIPLTEKGYWQI 261

  Fly   256 TANSVKIEG-ILLC-NGCQAIADTGTSLIAVPLRAYKAINKVLNATDAGDGEAFVDCSSLCRLPN 318
            ..::||::| .:.| :.||.|.|:|||||..|....|.:.::|.||....||..:|||.:..||.
 Frog   262 RLDNVKVDGEAMFCQSSCQVIVDSGTSLITGPKAEIKKLQELLGATPTLFGEYILDCSRVSSLPR 326

  Fly   319 VNLNIGGTTYTLTPKDYIYKVQADNNQTLCLSGFTYL----QGNLLWILGDIFLGKVYTVFDVGK 379
            |...||...|||||:.|..|.::..:. .||:||..:    :...||||||||:.|.|:|||...
 Frog   327 VTFTIGQRDYTLTPEQYTIKERSQKSD-FCLTGFQAMDISTKDGPLWILGDIFMSKFYSVFDREH 390

  Fly   380 ERIGFAK 386
            :|||.||
 Frog   391 DRIGLAK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:299705 140/324 (43%)
Asp 73..387 CDD:278455 141/321 (44%)
LOC100493461XP_002938556.2 A1_Propeptide 17..45 CDD:400357
pepsin_retropepsin_like 75..397 CDD:416259 140/324 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.