DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6508 and ctse

DIOPT Version :9

Sequence 1:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_001120469.1 Gene:ctse / 100145572 XenbaseID:XB-GENE-947864 Length:397 Species:Xenopus tropicalis


Alignment Length:394 Identity:157/394 - (39%)
Similarity:239/394 - (60%) Gaps:24/394 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QLIIIPLFLLLLDHSMGQLRRTPITRQ------INQNKTHANVKAEKILLAAKYFLVDRQSSQTT 63
            |::::.||..|:   .| |.|.|:.||      :.:....::|..::.:...:|......:...:
 Frog     3 QILLLLLFATLV---YG-LIRVPLKRQKSIRKKLKEKGKLSHVWTQQGIDMIQYTDSCSNNQAPS 63

  Fly    64 QVLANGFNLEYTIRLCIGTPPQCFNLQFDTGSSDLWVPSVKCSSTNEACQKHNKYNSSASSSHVE 128
            :.|.|..::||...:.||||||.|.:.||||||:||||||.|.|  .||.:||::....||::..
 Frog    64 EPLINYMDVEYFGEISIGTPPQNFTVIFDTGSSNLWVPSVYCIS--PACAQHNRFQPQFSSTYQS 126

  Fly   129 DGKGFSIQYGSGSLSGFLSTDTVDIDGMVIRNQTFAEAIDEPGSAFVNTIFDGIIGMAFASISGG 193
            :|..||:|||:|||||.:.||:|.::|:::::|.|.|::.||||.||:..||||:|:.:.||:.|
 Frog   127 NGNNFSLQYGTGSLSGIIGTDSVSVEGILVQSQQFGESVSEPGSTFVDAEFDGILGLGYPSIAVG 191

  Fly   194 VTTP-FDNIIRQGLVKHPVFSVYLRRDGTSQSGGEVIWGGIDRSIYRGCINYVPVSMPAYWQFTA 257
            ..|| |||::.|.||:.|:||||:.|:..|..|||:::||.|.|.:.|.:|:|.|:...|||...
 Frog   192 DCTPVFDNMMTQNLVELPMFSVYMSRNPNSPVGGELVFGGFDASRFSGQLNWVSVTNQGYWQIQL 256

  Fly   258 NSVKIEG-ILLC-NGCQAIADTGTSLIAVPLRAYKAINKVLNATDAGDGEAFVDCSSLCRLPNVN 320
            ::::|.| ::.| .|||||.|||||||..|......:..::.|: |.:|:..||||.|..:|.|.
 Frog   257 DNIQINGEVVFCTGGCQAIVDTGTSLITGPSSDIVQLQSIIGAS-AANGDYEVDCSVLNEMPTVT 320

  Fly   321 LNIGGTTYTLTPKDYIYKVQADNNQTLCLSGFTYLQ----GNLLWILGDIFLGKVYTVFDVGKER 381
            ..|.|..|.:||:.|..:    :...:|.|||..|.    ...||||||:|:|:.|:|||.|..|
 Frog   321 FTINGIGYQMTPQQYTLQ----DGGGICSSGFQGLDISPPAGPLWILGDVFIGQYYSVFDRGNNR 381

  Fly   382 IGFA 385
            :|.|
 Frog   382 VGLA 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:299705 144/325 (44%)
Asp 73..387 CDD:278455 143/320 (45%)
ctseNP_001120469.1 A1_Propeptide 17..42 CDD:369623 5/24 (21%)
pepsin_retropepsin_like 74..386 CDD:386101 142/319 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.