DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6724 and AT5G40880

DIOPT Version :9

Sequence 1:NP_609452.1 Gene:CG6724 / 34488 FlyBaseID:FBgn0032298 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_198904.1 Gene:AT5G40880 / 834089 AraportID:AT5G40880 Length:472 Species:Arabidopsis thaliana


Alignment Length:279 Identity:58/279 - (20%)
Similarity:112/279 - (40%) Gaps:65/279 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 ILTISGHTAPIKAVDWISLDEETGRFVSTSQDQTAMLWQWNVGS--------------------- 181
            :..:.||...||.   |:|.:.:.:..|.|.|.|.::|..|.|.                     
plant   180 VAALEGHKNDIKG---IALPQGSDKLFSVSGDGTLLIWDCNSGQCVRSINLQAEAGSLISEGPWV 241

  Fly   182 -----NSVECVSVCKGHERGVDSV------SVSPDGLRFATGSWDTMLKVWSAELDDAVEGSSKR 235
                 |:|:..:|....:..::.|      ..:.:|:.||..|..::| ||.|  .|:.....|.
plant   242 FLGLPNAVKAFNVQNSKDVHLEGVVGQVHAMTAANGMLFAGTSSGSIL-VWKA--TDSESDPFKY 303

  Fly   236 MKESGVRTPKITLQGHRESVSAVQWMDATTLLTGSWDHTLKVWDLSL----EGIKTEIST----- 291
            :         .:|:||.........:....|.:||.|.|:|||||:.    ..:|..|.|     
plant   304 L---------TSLEGHHSGEVTCFVVGGEVLYSGSVDKTIKVWDLNTLQCRMTLKQHIGTVTSLL 359

  Fly   292 --NKSIFDASYSKLNRLILTASADKNLRLYDPRTNQGSVVRNTYLG-HNAWVQTVMWSTTEE--- 350
              :|.:..:|.....:| ...|.:::|::...|..:.||  :|..| |:|..:.:|:.:.:.   
plant   360 CWDKCLISSSLDGTIKL-WACSENESLKVVQTRKQELSV--HTLCGMHDAEAKPIMFCSYQNGAV 421

  Fly   351 FLFVSGAYDNQNKLWDCRS 369
            .:|...:::.:.|::..::
plant   422 GIFDLPSFEERGKMFSTQT 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6724NP_609452.1 NLE 10..75 CDD:285380
WD40 105..>411 CDD:225201 58/279 (21%)
WD40 105..408 CDD:238121 58/279 (21%)
WD40 repeat 198..250 CDD:293791 12/57 (21%)
WD40 repeat 255..288 CDD:293791 11/36 (31%)
WD40 repeat 296..333 CDD:293791 7/36 (19%)
WD40 repeat 340..378 CDD:293791 3/33 (9%)
AT5G40880NP_198904.1 ZnF_C3H1 145..170 CDD:214632
WD40 168..472 CDD:225201 58/279 (21%)
WD40 179..465 CDD:295369 58/279 (21%)
WD40 repeat 270..310 CDD:293791 11/51 (22%)
WD40 repeat 315..349 CDD:293791 10/33 (30%)
WD40 repeat 356..396 CDD:293791 6/40 (15%)
WD40 repeat 403..437 CDD:293791 5/33 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19855
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.