DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and Ube2n

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_006514407.1 Gene:Ube2n / 93765 MGIID:1934835 Length:171 Species:Mus musculus


Alignment Length:175 Identity:74/175 - (42%)
Similarity:93/175 - (53%) Gaps:15/175 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GGASGSNAGGGDEPRKEAKTTPRISRALGTSAKRIQKELAEITLDPPPNCSAGPKGDNLYEWVST 121
            |||:|.     :.|.:|.      ...|..:|:..|:.|||    |.|...|.|...|...:...
Mouse     8 GGAAGR-----ERPLREG------HGVLPATAQETQRLLAE----PVPGIKAEPDESNARYFHVV 57

  Fly   122 ILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISK 186
            |.||..|.:|||.|.|::....|||...|||.|.|:|||.|::..|.||||||||.|||||.|..
Mouse    58 IAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRT 122

  Fly   187 VLLSICSLLTDCNPADPLVGSIATQYLQNREEHDRIARLWTKRYA 231
            |||||.:||:..||.|||...:|.|:..|..:....||.||:.||
Mouse   123 VLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 65/144 (45%)
UQ_con 90..227 CDD:278603 62/136 (46%)
Ube2nXP_006514407.1 UBCc 29..170 CDD:381827 66/143 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.