DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and UBC13

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_010377.3 Gene:UBC13 / 851666 SGDID:S000002499 Length:153 Species:Saccharomyces cerevisiae


Alignment Length:143 Identity:70/143 - (48%)
Similarity:89/143 - (62%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 KRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVT 153
            |||.||..::..||.|..:|.|..|||..:..||.||..|.||.|:|.|:::...:||.:.|||.
Yeast     6 KRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVR 70

  Fly   154 FRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQNREE 218
            |.|:|||.||:..|.||||:||.||||||.|..|||||.:||...||.|||...:|..:::|.:.
Yeast    71 FLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQG 135

  Fly   219 HDRIARLWTKRYA 231
            ....||.|||.||
Yeast   136 AKAKAREWTKLYA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 68/141 (48%)
UQ_con 90..227 CDD:278603 64/136 (47%)
UBC13NP_010377.3 UBCc 3..152 CDD:412187 70/143 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.