DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and UBC28

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001154446.1 Gene:UBC28 / 842728 AraportID:AT1G64230 Length:190 Species:Arabidopsis thaliana


Alignment Length:187 Identity:87/187 - (46%)
Similarity:111/187 - (59%) Gaps:42/187 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 SAKRIQKELAEITLDPPPNCSA------------------------------------------G 109
            ::|||.|||.::..|||.:|||                                          .
plant     2 ASKRILKELKDLQKDPPTSCSAVDNASKLLVLIELEDCCRRFSNCSCILLLEKSQDIAMAHVLLC 66

  Fly   110 PKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTFRTRIYHCNINSQGVICLDIL 174
            |..::::.|.:||:||..|.|.||||.:.|||.|:||||||||.|||:::|.|:||.|.||||||
plant    67 PVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGSICLDIL 131

  Fly   175 KDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQNREEHDRIARLWTKRYA 231
            |:.||||||||||||||||||||.||.||||..||..|..:|.:::..||.||::||
plant   132 KEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESTARSWTQKYA 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 85/185 (46%)
UQ_con 90..227 CDD:278603 82/178 (46%)
UBC28NP_001154446.1 COG5078 1..189 CDD:227410 87/187 (47%)
UBCc 1..188 CDD:294101 85/185 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.