DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and UBC31

DIOPT Version :10

Sequence 1:NP_477137.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_564472.1 Gene:UBC31 / 840541 AraportID:AT1G36340 Length:154 Species:Arabidopsis thaliana


Alignment Length:125 Identity:68/125 - (54%)
Similarity:85/125 - (68%) Gaps:0/125 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 SAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTFRTRIYHCNINSQGVICL 171
            |.|...:|:|||.:.|.||.|:.||||:|.|.|.|..:|||||||.||:|.|||.|||.:|.||:
plant    28 SIGQNSNNIYEWTAVIRGPDGTPYEGGMFNLSIKFPTDYPFKPPKFTFKTPIYHPNINDEGSICM 92

  Fly   172 DILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQNREEHDRIARLWTKRYA 231
            :||||.|:|||.:.||||||..||...||.||||..|...:..||.:.|:.||.:|.|:|
plant    93 NILKDKWTPALMVEKVLLSILLLLEKPNPDDPLVPEIGQLFKNNRFQFDQRAREFTARHA 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_477137.1 PHA03247 <4..158 CDD:223021 28/50 (56%)
UBCc_UBE2E 89..229 CDD:467413 66/121 (55%)
UBC31NP_564472.1 UBCc_UEV 28..151 CDD:483950 66/122 (54%)

Return to query results.
Submit another query.