DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and UBC27

DIOPT Version :10

Sequence 1:NP_477137.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001190508.1 Gene:UBC27 / 835159 AraportID:AT5G50870 Length:203 Species:Arabidopsis thaliana


Alignment Length:158 Identity:70/158 - (44%)
Similarity:91/158 - (57%) Gaps:19/158 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 RIQKELAEITLDPPPNCSAG----PKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPP 150
            ||||||.:...:..   |:|    ||.|||.....||.||.|:.||||.|.:||.....|||:||
plant     6 RIQKELQDCERNQD---SSGIRVCPKSDNLTRLTGTIPGPIGTPYEGGTFQIDITMPDGYPFEPP 67

  Fly   151 KVTFRTRIYHCNINSQ-GVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQ--- 211
            |:.|.|:::|.||:|| |.||||||||.||||||:...|:||.:||:...|.||....:|.|   
plant    68 KMQFSTKVWHPNISSQSGAICLDILKDQWSPALTLKTALVSIQALLSAPEPKDPQDAVVAEQVLL 132

  Fly   212 --------YLQNREEHDRIARLWTKRYA 231
                    |::|.:.....||.||:.:|
plant   133 LHHLNHLRYMKNYQVFVSTARYWTETFA 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_477137.1 PHA03247 <4..158 CDD:223021 33/71 (46%)
UBCc_UBE2E 89..229 CDD:467413 69/154 (45%)
UBC27NP_001190508.1 UBCc_UBE2K 4..158 CDD:467420 69/154 (45%)
UBA_II_E2_UBC27_like 166..201 CDD:270497
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.