DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and UBC8

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_568595.2 Gene:UBC8 / 834173 AraportID:AT5G41700 Length:149 Species:Arabidopsis thaliana


Alignment Length:146 Identity:88/146 - (60%)
Similarity:111/146 - (76%) Gaps:1/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 SAKRIQKELAEITLDPPPNC-SAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPP 150
            ::|||.|||.::..|||.:| .|||..::::.|.:||:||..|.|.||||.:.|||.|:||||||
plant     2 ASKRILKELKDLQKDPPTSCIFAGPVAEDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPP 66

  Fly   151 KVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQN 215
            ||.|||:::|.||||.|.|||||||:.||||||||||||||||||||.||.||||..||..|..:
plant    67 KVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 131

  Fly   216 REEHDRIARLWTKRYA 231
            |.:::..||.||::||
plant   132 RAKYEATARNWTQKYA 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 86/144 (60%)
UQ_con 90..227 CDD:278603 83/137 (61%)
UBC8NP_568595.2 COG5078 1..148 CDD:227410 88/146 (60%)
UBCc 1..147 CDD:294101 86/144 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.