DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and UBC12

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001319500.1 Gene:UBC12 / 820017 AraportID:AT3G08700 Length:149 Species:Arabidopsis thaliana


Alignment Length:146 Identity:82/146 - (56%)
Similarity:109/146 - (74%) Gaps:1/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 SAKRIQKELAEITLDPPPNCSAGPKG-DNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPP 150
            ::|||.:||.::...||.||||||.. ::::.|.:||:||..|.|.||||.:.|.||.:||||||
plant     2 ASKRISRELRDMQRHPPANCSAGPVAEEDIFHWQATIMGPHDSPYSGGVFTVSIDFSSDYPFKPP 66

  Fly   151 KVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQN 215
            ||.|:|::||.||:|:|.|||||||:.||||.|.|||||||||||||.||.||||..||..|..:
plant    67 KVNFKTKVYHPNIDSKGSICLDILKEQWSPAPTTSKVLLSICSLLTDPNPNDPLVPEIAHLYKVD 131

  Fly   216 REEHDRIARLWTKRYA 231
            :.:::..|:.||::||
plant   132 KSKYESTAQKWTQKYA 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 80/144 (56%)
UQ_con 90..227 CDD:278603 77/137 (56%)
UBC12NP_001319500.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.