DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and Ube2dnl2

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001075130.1 Gene:Ube2dnl2 / 75097 MGIID:1922347 Length:155 Species:Mus musculus


Alignment Length:149 Identity:95/149 - (63%)
Similarity:112/149 - (75%) Gaps:1/149 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LGTSA-KRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPF 147
            ||..| |||||||..|:.|||.:|||||..:|::.|.:||:||..|.|:||||||.:||...|||
Mouse     6 LGAMALKRIQKELVAISQDPPAHCSAGPVAENMFHWQATIMGPEDSPYQGGVFFLSVHFPNNYPF 70

  Fly   148 KPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQY 212
            |||||||.||:||.||:..|.||||||...|||||||||:||||||||.|.||.||||..||..|
Mouse    71 KPPKVTFITRVYHPNISKNGSICLDILNSMWSPALTISKLLLSICSLLCDPNPDDPLVPEIAKVY 135

  Fly   213 LQNREEHDRIARLWTKRYA 231
            .::..|::|:||.||||||
Mouse   136 RKDLREYNRLAREWTKRYA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 91/145 (63%)
UQ_con 90..227 CDD:278603 85/136 (63%)
Ube2dnl2NP_001075130.1 COG5078 9..155 CDD:227410 93/146 (64%)
UBCc 9..154 CDD:294101 91/144 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833296
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.