DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and UBE2E2

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001357154.1 Gene:UBE2E2 / 7325 HGNCID:12478 Length:201 Species:Homo sapiens


Alignment Length:215 Identity:153/215 - (71%)
Similarity:166/215 - (77%) Gaps:24/215 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 STTASNVSNTSQPTTAGTPQARGGRGSNANGGASGSNAGG-GDEP--------RKEAKTTPRISR 82
            ||.|..|.::  |:|:|             |.:.|..... ..||        :||.|.:.:.:.
Human     2 STEAQRVDDS--PSTSG-------------GSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAA 51

  Fly    83 ALGTSAKRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPF 147
            .|.|||||||||||||||||||||||||||||:|||.||||||||||||||||||||.|||:|||
Human    52 KLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPF 116

  Fly   148 KPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQY 212
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Human   117 KPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQY 181

  Fly   213 LQNREEHDRIARLWTKRYAT 232
            :.||.||||:||.|||||||
Human   182 MTNRAEHDRMARQWTKRYAT 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 135/144 (94%)
UQ_con 90..227 CDD:278603 127/136 (93%)
UBE2E2NP_001357154.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 15/67 (22%)
UQ_con 59..196 CDD:395127 127/136 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 271 1.000 Domainoid score I1821
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H77337
Inparanoid 1 1.050 301 1.000 Inparanoid score I2691
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 1 1.000 - - FOG0002573
OrthoInspector 1 1.000 - - otm40329
orthoMCL 1 0.900 - - OOG6_103488
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4811
SonicParanoid 1 1.000 - - X1929
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.