DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and Ube2c

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_081061.1 Gene:Ube2c / 68612 MGIID:1915862 Length:179 Species:Mus musculus


Alignment Length:202 Identity:68/202 - (33%)
Similarity:88/202 - (43%) Gaps:44/202 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SNTSQPTTAGTPQARGGRGSNANGGASGSNAGGGDEPRKEAKTTPRISRALGTSAKRIQKELAEI 98
            |....|..|.....|  :|:...|||                       |.|...||:|:||..:
Mouse     3 SQNRDPAAASVAAVR--KGAEPCGGA-----------------------ARGPVGKRLQQELMIL 42

  Fly    99 TLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTFRTRIYHCNI 163
            ........||.|:.|||::||.||.|..|:|||...:.|.:.|...||:..|.|.|.|..||.|:
Mouse    43 MTSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNV 107

  Fly   164 NSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQNREEHDRIARLWT- 227
            ::||.||||||||.||....:..:||||.|||.:.|...||              :...|.||. 
Mouse   108 DTQGNICLDILKDKWSALYDVRTILLSIQSLLGEPNIDSPL--------------NTHAAELWKN 158

  Fly   228 ----KRY 230
                |:|
Mouse   159 PTAFKKY 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 58/150 (39%)
UQ_con 90..227 CDD:278603 54/136 (40%)
Ube2cNP_081061.1 UQ_con 34..170 CDD:306648 57/146 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.