DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and Ube2g1

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_080261.2 Gene:Ube2g1 / 67128 MGIID:1914378 Length:170 Species:Mus musculus


Alignment Length:162 Identity:55/162 - (33%)
Similarity:87/162 - (53%) Gaps:16/162 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 SAKRIQKELAEITLDPPPNCSAGPKGDN-LYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPP 150
            ||..::::|||:..:|....|||...|| ||.|...|:|||.::||||||...:.|..:||.:||
Mouse     6 SALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPP 70

  Fly   151 KVTFRTRIYHCNINSQGVICLDIL-------------KDNWSPALTISKVLLSICSLLTDCNPAD 202
            |:.|.|.|:|.|::..|.:|:.||             ::.|.|..|:..:::|:.|:|.|.|...
Mouse    71 KMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDS 135

  Fly   203 PLVGSIATQYLQNR--EEHDRIARLWTKRYAT 232
            |.....|.::.::|  |...::||...|...|
Mouse   136 PANVDAAKEWREDRNGEFKRKVARCVRKSQET 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 54/159 (34%)
UQ_con 90..227 CDD:278603 51/152 (34%)
Ube2g1NP_080261.2 UQ_con 10..161 CDD:395127 51/150 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.