DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and ube2e1

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001096586.1 Gene:ube2e1 / 563542 ZFINID:ZDB-GENE-071004-16 Length:195 Species:Danio rerio


Alignment Length:218 Identity:152/218 - (69%)
Similarity:168/218 - (77%) Gaps:25/218 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SSATSNAPSAPSTTASNVSNTSQPTTAGTPQARGGRGSNANGGASGSNAGGGDEPRKEAKTT-PR 79
            |...|.|.|:.|:::|: |:|.|.....||    |:                   :||:|.. .:
Zfish     2 SDEDSRASSSSSSSSSS-SSTHQQQEKDTP----GK-------------------KKESKANMSK 42

  Fly    80 ISRALGTSAKRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPE 144
            .|:.|.|||||||||||:|.|||||||||||||||:|||.||||||||||||||||||||.|:|:
Zfish    43 TSKLLSTSAKRIQKELADIMLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDIAFTPD 107

  Fly   145 YPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIA 209
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish   108 YPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIA 172

  Fly   210 TQYLQNREEHDRIARLWTKRYAT 232
            |||..||.||||||:.|||||||
Zfish   173 TQYTTNRPEHDRIAKQWTKRYAT 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 132/144 (92%)
UQ_con 90..227 CDD:278603 124/136 (91%)
ube2e1NP_001096586.1 COG5078 48..194 CDD:227410 132/145 (91%)
UQ_con 53..190 CDD:278603 124/136 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4811
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.