DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and ube2i

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001016408.1 Gene:ube2i / 549162 XenbaseID:XB-GENE-974017 Length:158 Species:Xenopus tropicalis


Alignment Length:154 Identity:54/154 - (35%)
Similarity:79/154 - (51%) Gaps:7/154 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 GTSAKRIQKELAEITLDPPPNCSAGPKGD-----NLYEWVSTILGPPGSVYEGGVFFLDIHFSPE 144
            |.:..|:.:|......|.|....|.|..:     ||..|...|.|..|:.:|||:|.|.:.|..:
 Frog     3 GIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDD 67

  Fly   145 YPFKPPKVTFRTRIYHCNINSQGVICLDILKD--NWSPALTISKVLLSICSLLTDCNPADPLVGS 207
            ||..|||..|...::|.|:...|.:||.||::  :|.||:||.::||.|..||.:.|..||....
 Frog    68 YPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAE 132

  Fly   208 IATQYLQNREEHDRIARLWTKRYA 231
            ..|.|.|||.|:::..|...|::|
 Frog   133 AYTIYCQNRVEYEKRVRAQAKKFA 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 52/151 (34%)
UQ_con 90..227 CDD:278603 51/143 (36%)
ube2iNP_001016408.1 UQ_con 8..152 CDD:395127 51/143 (36%)
Interaction with sumo1. /evidence=ECO:0000250 13..18 0/4 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.