DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and UBE2D4

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_024302563.1 Gene:UBE2D4 / 51619 HGNCID:21647 Length:192 Species:Homo sapiens


Alignment Length:179 Identity:97/179 - (54%)
Similarity:119/179 - (66%) Gaps:16/179 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SNANGGASGSNAGGGDEPRKEAKTTPRISRALGTSAKRIQKELAEITLDPPPNCSAGPKGDNLYE 117
            ::|:|.||||.........|:|                ...||.::..|||..|||||.||:|:.
Human    29 ASASGEASGSLQSWQKAKEKQA----------------CHLELTDLQRDPPAQCSAGPVGDDLFH 77

  Fly   118 WVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPAL 182
            |.:||:||..|.|:||||||.|||..:||||||||.|.|:|||.||||.|.||||||:..|||||
Human    78 WQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPAL 142

  Fly   183 TISKVLLSICSLLTDCNPADPLVGSIATQYLQNREEHDRIARLWTKRYA 231
            |:|||||||||||.|.||.||||..||..|..:||:::|:||.||::||
Human   143 TVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYA 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 87/144 (60%)
UQ_con 90..227 CDD:278603 85/136 (63%)
UBE2D4XP_024302563.1 UBCc 54..191 CDD:320784 87/136 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.