DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and ube2z

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001002330.2 Gene:ube2z / 436602 ZFINID:ZDB-GENE-040718-15 Length:380 Species:Danio rerio


Alignment Length:215 Identity:64/215 - (29%)
Similarity:88/215 - (40%) Gaps:45/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TPAAGSAAEVATSSATSNAPSAPSTTASNVSNTSQPTTAGTPQARGGRGSNANGGA---SGSNAG 65
            |||..|...|.|.:.:|..|                 .|..|....|.||....||   |..:|.
Zfish    58 TPAVESGLGVLTHAVSSTVP-----------------VAVLPSLPPGIGSGVPAGAGLLSQIHAT 105

  Fly    66 GGDEPRKEAKTTPRIS------RALGTSAKRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILG 124
            ..|         |.:|      :|......||::::..|..:|||.....|...::.:..:.|.|
Zfish   106 SWD---------PTLSTDWDNEKASQQCILRIKRDIMSIYKEPPPGMFVVPDPHDMTKIHALITG 161

  Fly   125 PPGSVYEGGVFFLDIHFSPEYPFKPPKVTF-----RTRIYHCNINSQGVICLDIL----KDNWSP 180
            |..:.||||.|.......|:||..||:|..     .|..::.|....|.:||.||    ...|||
Zfish   162 PFDTPYEGGFFLFLFRCPPDYPIHPPRVKLITTGHNTVRFNPNFYRNGKVCLSILGTWTGPAWSP 226

  Fly   181 ALTISKVLLSICSLLTDCNP 200
            |.:||.||:||.||:|: ||
Zfish   227 AQSISSVLISIQSLMTE-NP 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 43/124 (35%)
UQ_con 90..227 CDD:278603 43/120 (36%)
ube2zNP_001002330.2 UBCc 127..245 CDD:238117 41/118 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.