DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and CG10254

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster


Alignment Length:245 Identity:55/245 - (22%)
Similarity:90/245 - (36%) Gaps:69/245 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VATSSATSNAPSAPSTTASNVSNTSQPTTAGTPQARGGRGSNANGGASGSNAGGGDEPRKEAKTT 77
            ||.:...:|  ..|.....:||:..:...|.:.:|     ..||.||:..|....||..:|....
  Fly  1003 VAVTLGKTN--DNPKQEKEDVSDAEEAIEAVSQEA-----ELANDGATECNTMAEDEAMEEPLNL 1060

  Fly    78 PRISRAL----GTSAKRIQKELAEITLDPP----------PNCSAG------------------- 109
            ..:|.:|    .|...........|..|.|          ||..|.                   
  Fly  1061 NALSESLPAIDQTGPMACSSPSWSIIPDTPSVDENCFQVLPNAPAAHNFISNLITPANKAQYQRA 1125

  Fly   110 ------------PKG------DNLYEWVSTIL-GPPGSVYEGGVFFLDIHFSPEYPFKPP---KV 152
                        |.|      ::..:.:|.:: ||..:.|:..:||.|..|..:||..||   .:
  Fly  1126 VQREYLMLKSSLPNGVVVRAYEDRMDLMSVMMVGPKRTPYQNALFFFDFQFGRDYPKSPPVCHYI 1190

  Fly   153 TFRTRIYHCNINSQGVICLDIL-----KDN--WSPALTISKVLLSICSLL 195
            ::.|...:.|:...|.:|:.:|     :||  |||:.|:.:||:||..|:
  Fly  1191 SYCTDRLNPNLYEGGRVCVSLLGTWMGRDNEVWSPSSTMLQVLVSIQGLI 1240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 37/168 (22%)
UQ_con 90..227 CDD:278603 36/164 (22%)
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 30/115 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.