DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and Ubc84D

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster


Alignment Length:156 Identity:47/156 - (30%)
Similarity:85/156 - (54%) Gaps:12/156 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 TPRISRALGTSAKRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHF 141
            |.|::|.|        .:|.|..:....|..:  ..::|..|.. :|.|..:.|..|.|.::|:|
  Fly     4 TRRLTREL--------SDLVEAKMSTLRNIES--SDESLLMWTG-LLVPEKAPYNKGAFRIEINF 57

  Fly   142 SPEYPFKPPKVTFRTRIYHCNINSQGVICLDILK-DNWSPALTISKVLLSICSLLTDCNPADPLV 205
            .|:|||.|||:.|:|:|||.|::.:|.:||.|:. |||.|.....:||.::.:::.:..|..||.
  Fly    58 PPQYPFMPPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLR 122

  Fly   206 GSIATQYLQNREEHDRIARLWTKRYA 231
            ..:|.::::..::..:.|..:||:.|
  Fly   123 SDLAEEFVREHKKFMKTAEEFTKKNA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 42/145 (29%)
UQ_con 90..227 CDD:278603 40/137 (29%)
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 47/156 (30%)
UBCc 6..149 CDD:214562 46/154 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442225
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.