DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and Ubc84D

DIOPT Version :10

Sequence 1:NP_477137.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster


Alignment Length:156 Identity:47/156 - (30%)
Similarity:85/156 - (54%) Gaps:12/156 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 TPRISRALGTSAKRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHF 141
            |.|::|.|        .:|.|..:....|..:  ..::|..|.. :|.|..:.|..|.|.::|:|
  Fly     4 TRRLTREL--------SDLVEAKMSTLRNIES--SDESLLMWTG-LLVPEKAPYNKGAFRIEINF 57

  Fly   142 SPEYPFKPPKVTFRTRIYHCNINSQGVICLDILK-DNWSPALTISKVLLSICSLLTDCNPADPLV 205
            .|:|||.|||:.|:|:|||.|::.:|.:||.|:. |||.|.....:||.::.:::.:..|..||.
  Fly    58 PPQYPFMPPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLR 122

  Fly   206 GSIATQYLQNREEHDRIARLWTKRYA 231
            ..:|.::::..::..:.|..:||:.|
  Fly   123 SDLAEEFVREHKKFMKTAEEFTKKNA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_477137.1 PHA03247 <4..158 CDD:223021 25/80 (31%)
UBCc_UBE2E 89..229 CDD:467413 41/140 (29%)
Ubc84DNP_524260.1 UBCc_UBE2L3 3..149 CDD:467421 47/156 (30%)

Return to query results.
Submit another query.