DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and ube2e3

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_012825720.2 Gene:ube2e3 / 394925 XenbaseID:XB-GENE-980957 Length:256 Species:Xenopus tropicalis


Alignment Length:253 Identity:160/253 - (63%)
Similarity:174/253 - (68%) Gaps:32/253 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSTPAA--GSAAEVATSSATSNAPSA--PSTTAS-NVSNTSQPTTAGTPQARGGRGSNANGGASG 61
            |:.|.:  ||........|.:.||..  |..|.| .:|:..|.:...:|....|          .
 Frog    14 SAFPGSPGGSGTHSGVRRAGTGAPGRLHPEETESIKMSSDRQRSDDESPSTSSG----------S 68

  Fly    62 SNAGGGDEP-----------------RKEAKTTPRISRALGTSAKRIQKELAEITLDPPPNCSAG 109
            |:|...|.|                 :|..|.:.:.:..|.||||||||||||||||||||||||
 Frog    69 SDADQRDPPAPEPEEQEERKPSAVQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAG 133

  Fly   110 PKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTFRTRIYHCNINSQGVICLDIL 174
            |||||:|||.||||||||||||||||||||.||.:||||||||||||||||||||||||||||||
 Frog   134 PKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDIL 198

  Fly   175 KDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQNREEHDRIARLWTKRYAT 232
            |||||||||||||||||||||||||||||||||||||||.||.|||||||.|||||||
 Frog   199 KDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 136/144 (94%)
UQ_con 90..227 CDD:278603 128/136 (94%)
ube2e3XP_012825720.2 UQ_con 114..251 CDD:395127 128/136 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 271 1.000 Domainoid score I1784
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 304 1.000 Inparanoid score I2612
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 1 1.000 - - FOG0002573
OrthoInspector 1 1.000 - - otm47503
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4811
SonicParanoid 1 1.000 - - X1929
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.