DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and Ube2d1

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_017457176.1 Gene:Ube2d1 / 361831 RGDID:1307886 Length:194 Species:Rattus norvegicus


Alignment Length:179 Identity:95/179 - (53%)
Similarity:121/179 - (67%) Gaps:19/179 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DEPRKEAKTTPRISRALGTSAKRIQ---------------KELAEITLDPPPNCSAGPKGDNLYE 117
            ::|:.||...    .||.||.:|..               .||:::..|||.:|||||.||:|:.
  Rat    19 NKPKFEAAAV----IALLTSDRRCSVGFPFGSFQTLLLFVMELSDLQRDPPAHCSAGPVGDDLFH 79

  Fly   118 WVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPAL 182
            |.:||:|||.|.|:||||||.:||..:|||||||:.|.|:|||.||||.|.||||||:..|||||
  Rat    80 WQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPAL 144

  Fly   183 TISKVLLSICSLLTDCNPADPLVGSIATQYLQNREEHDRIARLWTKRYA 231
            |:|||||||||||.|.||.||||..||..|..::|:::|.||.||::||
  Rat   145 TVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 88/159 (55%)
UQ_con 90..227 CDD:278603 84/151 (56%)
Ube2d1XP_017457176.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.