DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and Ube2e2

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_038949373.1 Gene:Ube2e2 / 361013 RGDID:1305644 Length:201 Species:Rattus norvegicus


Alignment Length:215 Identity:153/215 - (71%)
Similarity:166/215 - (77%) Gaps:24/215 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 STTASNVSNTSQPTTAGTPQARGGRGSNANGGASGSNAGG-GDEP--------RKEAKTTPRISR 82
            ||.|..|.::  |:|:|             |.:.|..... ..||        :||.|.:.:.:.
  Rat     2 STEAQRVDDS--PSTSG-------------GSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAA 51

  Fly    83 ALGTSAKRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPF 147
            .|.|||||||||||||||||||||||||||||:|||.||||||||||||||||||||.|||:|||
  Rat    52 KLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPF 116

  Fly   148 KPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQY 212
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   117 KPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQY 181

  Fly   213 LQNREEHDRIARLWTKRYAT 232
            :.||.||||:||.|||||||
  Rat   182 MTNRAEHDRMARQWTKRYAT 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 135/144 (94%)
UQ_con 90..227 CDD:278603 127/136 (93%)
Ube2e2XP_038949373.1 UQ_con 59..196 CDD:395127 127/136 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H77337
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 1 1.000 - - FOG0002573
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103488
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.