DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and Ube2t

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001101814.2 Gene:Ube2t / 360847 RGDID:1310816 Length:204 Species:Rattus norvegicus


Alignment Length:148 Identity:59/148 - (39%)
Similarity:89/148 - (60%) Gaps:4/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 AKRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKV 152
            |.|::|||..:.::|||..:...:.|.:....:.|||...:.||.|:|.|::.....|||:||::
  Rat     4 ASRLKKELHMLAIEPPPGVTCWQEKDKMDNLRAQILGGANTPYEKGIFTLEVIVPERYPFEPPQI 68

  Fly   153 TFRTRIYHCNINSQGVICLDIL----KDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYL 213
            .|.|.|||.||:|.|.||||||    |..|.|:|.|:.||.||..|:.:.||.|||:..|::::.
  Rat    69 RFLTPIYHPNIDSSGRICLDILKLPPKGAWRPSLNIATVLTSIQLLMAEPNPDDPLMADISSEFK 133

  Fly   214 QNREEHDRIARLWTKRYA 231
            .|:....:.||.||:.:|
  Rat   134 YNKIAFVKKARQWTETHA 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 58/146 (40%)
UQ_con 90..227 CDD:278603 55/140 (39%)
Ube2tNP_001101814.2 UBCc 5..147 CDD:238117 55/141 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.