DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and CG4502

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster


Alignment Length:217 Identity:53/217 - (24%)
Similarity:89/217 - (41%) Gaps:46/217 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ATSNAPSAPSTTASNVSNTSQ-----PTTAGTPQARGGR-GSNANGGASGSNA------------ 64
            ||.::|:..:...:|.:|.:.     |::||.....||. ||:.:.||: .||            
  Fly    47 ATGSSPNINNNNNNNNNNNNHDGAAAPSSAGGVAVAGGAVGSSGSSGAA-KNAVVRMAAEQAVWD 110

  Fly    65 GGGDEPRKEAKTTPRISRALGTS------AKRIQKELAEITLDPPPN---CSAGPKGDNLYEW-V 119
            ..|...|::.|..|...|.|..:      .:|:.||..|:......|   .:.....|:|:|| |
  Fly   111 SPGKRRRQDHKVAPTTERQLVAAPDHTIRTRRLMKEYREMERLQAKNDAVFTVELVNDSLFEWHV 175

  Fly   120 STILGPPGS-----VYEGGV--FFLDIHFSPEYPFKPPKVTFRTRIYHCNIN-----SQGVICLD 172
            ...:..|.|     :.|.||  ..|.:.|...:||.||.:    |:...:|.     ..|.||::
  Fly   176 RLHVIDPDSPLARDMAEMGVPAILLHLSFPDNFPFAPPFM----RVVEPHIEKGYVMEGGAICME 236

  Fly   173 ILKD-NWSPALTISKVLLSICS 193
            :|.. .|:.|.|:..|::...:
  Fly   237 LLTPRGWASAYTVEAVIMQFAA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 31/131 (24%)
UQ_con 90..227 CDD:278603 31/121 (26%)
CG4502NP_609103.1 UBCc 140..>258 CDD:238117 31/121 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442222
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.