DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and ube2d3

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_005156599.1 Gene:ube2d3 / 321832 ZFINID:ZDB-GENE-030131-551 Length:148 Species:Danio rerio


Alignment Length:143 Identity:93/143 - (65%)
Similarity:111/143 - (77%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 KRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVT 153
            |||||||.::..|||..|||||.||:::.|.:||:||..|.|:||||||.|||..:||||||||.
Zfish     4 KRIQKELTDLARDPPAQCSAGPVGDDVFHWQATIMGPNESPYQGGVFFLTIHFPTDYPFKPPKVA 68

  Fly   154 FRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQNREE 218
            |.|||||.||||.|.||||||:..||||||||||||||||||.|.||.||||..||..|..:.|:
Zfish    69 FTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDTEK 133

  Fly   219 HDRIARLWTKRYA 231
            ::|:|:.||::||
Zfish   134 YNRMAKEWTEKYA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 91/141 (65%)
UQ_con 90..227 CDD:278603 88/136 (65%)
ube2d3XP_005156599.1 UBCc 1..146 CDD:412187 91/141 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.