DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and UbcE2H

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_572438.1 Gene:UbcE2H / 31728 FlyBaseID:FBgn0029996 Length:183 Species:Drosophila melanogaster


Alignment Length:120 Identity:46/120 - (38%)
Similarity:65/120 - (54%) Gaps:2/120 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTFRTRIYHCNIN-SQGVICLDILKDNW 178
            |.|:.....||..:.|||||:.:.::....||||.|.:.|..:|||.||: |.|.:|||::...|
  Fly    31 LNEFHVKFFGPTETPYEGGVWKVRVYLPDNYPFKSPSIGFVNKIYHPNIDESSGTVCLDVINQAW 95

  Fly   179 SPALTISKVLLS-ICSLLTDCNPADPLVGSIATQYLQNREEHDRIARLWTKRYAT 232
            :....:|.:..| :..|||..||.|||....|..||...||:.|....:.:||||
  Fly    96 TALYDLSNIFESFLPQLLTYPNPVDPLNRDAAALYLHEPEEYHRKVADYVQRYAT 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 43/117 (37%)
UQ_con 90..227 CDD:278603 42/113 (37%)
UbcE2HNP_572438.1 COG5078 1..149 CDD:227410 43/117 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.