DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and UBE2K

DIOPT Version :10

Sequence 1:NP_477137.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_005330.1 Gene:UBE2K / 3093 HGNCID:4914 Length:200 Species:Homo sapiens


Alignment Length:147 Identity:63/147 - (42%)
Similarity:81/147 - (55%) Gaps:16/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 TSAKRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPP 150
            ||..:|:.:|.:               :|..|....|.|||.:.||||.:.|:|.....|||.||
Human    22 TSKNQIKVDLVD---------------ENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPP 71

  Fly   151 KVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQ 214
            ||.|.|:|:|.||:| .|.||||||||.|:.|:|:..||||:.:||....|.||....:|.||.|
Human    72 KVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQ 136

  Fly   215 NREEHDRIARLWTKRYA 231
            |.|...:.||||...||
Human   137 NPEMFKQTARLWAHVYA 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_477137.1 PHA03247 <4..158 CDD:223021 25/71 (35%)
UBCc_UBE2E 89..229 CDD:467413 59/140 (42%)
UBE2KNP_005330.1 UBCc_UBE2K 6..151 CDD:467420 61/143 (43%)
UBA_II_E2_UBE2K 163..200 CDD:270573
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.