DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and Ube2e3

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001041322.2 Gene:Ube2e3 / 295686 RGDID:1308894 Length:207 Species:Rattus norvegicus


Alignment Length:236 Identity:156/236 - (66%)
Similarity:170/236 - (72%) Gaps:33/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSTPAAGSAAEVATSSATSNA----PSAPSTTASNVSNTSQPTTAGTPQARGGRGSNANGGASG 61
            |||..........:|||.:|:|    |:||.                 |:.:..|..:|.     
  Rat     1 MSSDRQRSDDESPSTSSGSSDADQRDPAAPE-----------------PEEQEERKPSAT----- 43

  Fly    62 SNAGGGDEPRKEAKTTPRISRALGTSAKRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPP 126
                   :.:|..|.:.:.:..|.|||||||||||||||||||||||||||||:|||.|||||||
  Rat    44 -------QQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPP 101

  Fly   127 GSVYEGGVFFLDIHFSPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSI 191
            |||||||||||||.||.:|||||||||||||||||||||||||||||||||||||||||||||||
  Rat   102 GSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSI 166

  Fly   192 CSLLTDCNPADPLVGSIATQYLQNREEHDRIARLWTKRYAT 232
            ||||||||||||||||||||||.||.|||||||.|||||||
  Rat   167 CSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 136/144 (94%)
UQ_con 90..227 CDD:278603 128/136 (94%)
Ube2e3NP_001041322.2 UQ_con 65..202 CDD:395127 128/136 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 270 1.000 Domainoid score I1756
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 1 1.000 - - FOG0002573
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.