DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and ubc14

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_594859.1 Gene:ubc14 / 2541565 PomBaseID:SPAC1250.03 Length:155 Species:Schizosaccharomyces pombe


Alignment Length:153 Identity:64/153 - (41%)
Similarity:93/153 - (60%) Gaps:1/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ISRALGTSAKRIQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPE 144
            ::.|..:|::|:.||.:::...|.|:.......|||:.|..|.|||..|||.||.|...:.|..:
pombe     1 MASASPSSSRRLTKEYSDLREHPIPDIRVNLVDDNLFHWACTALGPSDSVYAGGKFHFSLKFPLD 65

  Fly   145 YPFKPPKVTFRTRIYHCNINSQGVICLDILKDN-WSPALTISKVLLSICSLLTDCNPADPLVGSI 208
            |||:||.:.|.|||||.|.:|:|.:||.|||.. :.|::.:..||..|..||.:.||.||||.||
pombe    66 YPFQPPTIEFTTRIYHPNFDSEGNVCLAILKQQVFKPSIKLRSVLEQILQLLREPNPDDPLVASI 130

  Fly   209 ATQYLQNREEHDRIARLWTKRYA 231
            |.||..:|...|:|||.:.:::|
pombe   131 AEQYRNDRPSFDKIARDYVEQFA 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 62/145 (43%)
UQ_con 90..227 CDD:278603 61/137 (45%)
ubc14NP_594859.1 COG5078 12..154 CDD:227410 61/142 (43%)
UQ_con 12..149 CDD:278603 60/136 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.