DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and uev-3

DIOPT Version :10

Sequence 1:NP_477137.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001361859.1 Gene:uev-3 / 185003 WormBaseID:WBGene00006732 Length:356 Species:Caenorhabditis elegans


Alignment Length:56 Identity:23/56 - (41%)
Similarity:29/56 - (51%) Gaps:10/56 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 GPPGSVYEGGVFFLDIHFSP-EYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNW 178
            ||.||:||||.||.||:..| :.....|:|.|.|.|:|.|:...|         ||
 Worm   207 GPVGSIYEGGTFFADINIQPYQNHSLIPRVCFHTFIFHPNLGKYG---------NW 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_477137.1 PHA03247 <4..158 CDD:223021 17/34 (50%)
UBCc_UBE2E 89..229 CDD:467413 23/56 (41%)
uev-3NP_001361859.1 PHA03247 <9..73 CDD:223021
UBCc_UEV 179..275 CDD:467407 23/56 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.