powered by:
Protein Alignment Ubc2 and uev-3
DIOPT Version :9
Sequence 1: | NP_001260362.1 |
Gene: | Ubc2 / 34487 |
FlyBaseID: | FBgn0015320 |
Length: | 232 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001361859.1 |
Gene: | uev-3 / 185003 |
WormBaseID: | WBGene00006732 |
Length: | 356 |
Species: | Caenorhabditis elegans |
Alignment Length: | 56 |
Identity: | 23/56 - (41%) |
Similarity: | 29/56 - (51%) |
Gaps: | 10/56 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 124 GPPGSVYEGGVFFLDIHFSP-EYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNW 178
||.||:||||.||.||:..| :.....|:|.|.|.|:|.|:...| ||
Worm 207 GPVGSIYEGGTFFADINIQPYQNHSLIPRVCFHTFIFHPNLGKYG---------NW 253
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0417 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.