DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and uev-3

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001361859.1 Gene:uev-3 / 185003 WormBaseID:WBGene00006732 Length:356 Species:Caenorhabditis elegans


Alignment Length:56 Identity:23/56 - (41%)
Similarity:29/56 - (51%) Gaps:10/56 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 GPPGSVYEGGVFFLDIHFSP-EYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNW 178
            ||.||:||||.||.||:..| :.....|:|.|.|.|:|.|:...|         ||
 Worm   207 GPVGSIYEGGTFFADINIQPYQNHSLIPRVCFHTFIFHPNLGKYG---------NW 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 23/56 (41%)
UQ_con 90..227 CDD:278603 23/56 (41%)
uev-3NP_001361859.1 PHA03247 <9..73 CDD:223021
UBCc 185..319 CDD:381827 23/56 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.