DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and ube2d4

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_012814892.1 Gene:ube2d4 / 100497147 XenbaseID:XB-GENE-962537 Length:159 Species:Xenopus tropicalis


Alignment Length:138 Identity:87/138 - (63%)
Similarity:107/138 - (77%) Gaps:0/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 ELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTFRTRI 158
            ||.::..|||..|||||.|::|:.|.:||:||..|.::||||||.|||..:||||||||.|.|:|
 Frog    21 ELMDLQRDPPAQCSAGPVGEDLFHWQATIMGPNDSPFQGGVFFLTIHFPTDYPFKPPKVAFTTKI 85

  Fly   159 YHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQNREEHDRIA 223
            ||.||||.|.||||||:..||||||:|||||||||||.|.||.||||..||..|..:||:::|:|
 Frog    86 YHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLA 150

  Fly   224 RLWTKRYA 231
            |.||::||
 Frog   151 REWTQKYA 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 85/136 (63%)
UQ_con 90..227 CDD:278603 83/132 (63%)
ube2d4XP_012814892.1 COG5078 21..159 CDD:227410 87/138 (63%)
UBCc 21..158 CDD:294101 85/136 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53976
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.