DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and ube2e2

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001119983.1 Gene:ube2e2 / 100144938 XenbaseID:XB-GENE-5800934 Length:201 Species:Xenopus tropicalis


Alignment Length:207 Identity:151/207 - (72%)
Similarity:165/207 - (79%) Gaps:8/207 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 STTASNVSNTSQPTTAGTPQARGGRGSNANGGASGSNAGGGDEP-RKEAKTTPRISRALGTSAKR 90
            ||....|.::  |:|:|     |....:...|..........:| :||.|.:.:.:..|.|||||
 Frog     2 STEGQRVDDS--PSTSG-----GSSDGDQRDGVQNEQDREKVQPKKKEGKISSKTAAKLSTSAKR 59

  Fly    91 IQKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTFR 155
            ||||||||||||||||||||||||:|||.||||||||||||||||||||.|||:|||||||||||
 Frog    60 IQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDIAFSPDYPFKPPKVTFR 124

  Fly   156 TRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQNREEHD 220
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||:.||.|||
 Frog   125 TRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHD 189

  Fly   221 RIARLWTKRYAT 232
            |:||.|||||||
 Frog   190 RMARQWTKRYAT 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 135/144 (94%)
UQ_con 90..227 CDD:278603 127/136 (93%)
ube2e2NP_001119983.1 UQ_con 59..196 CDD:365926 127/136 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H77337
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.