DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc2 and ube2g1b

DIOPT Version :9

Sequence 1:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_998695.1 Gene:ube2g1b / 100000479 ZFINID:ZDB-GENE-040426-2939 Length:169 Species:Danio rerio


Alignment Length:154 Identity:48/154 - (31%)
Similarity:81/154 - (52%) Gaps:16/154 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 SAKRIQKELAEITLDPPPNCSAG-PKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPP 150
            ||..::|:|||:..:|....||| ...|::|:|...::||..:::|||.|...:.|..:||.:||
Zfish     5 SALLLRKQLAELNKNPVEGFSAGLIDDDDIYQWEVVVIGPQDTMFEGGFFKAHLIFPHDYPLRPP 69

  Fly   151 KVTFRTRIYHCNINSQGVICLDIL-------------KDNWSPALTISKVLLSICSLLTDCNPAD 202
            |:.|.|.|:|.|:...|.:|:.||             ::.|.|..|:..:::|:.|:|.|.|...
Zfish    70 KMKFITEIWHPNVAKNGDVCISILHEPGEDKFGYEKPEERWLPIHTVETIMISVISMLADPNGDS 134

  Fly   203 PLVGSIATQYLQ--NREEHDRIAR 224
            |.....|.::..  |.|...::||
Zfish   135 PANVDAAKEWRDDPNGEFKRKVAR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 48/154 (31%)
UQ_con 90..227 CDD:278603 46/151 (30%)
ube2g1bNP_998695.1 COG5078 1..163 CDD:227410 48/154 (31%)
UQ_con 9..160 CDD:278603 46/150 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.