Sequence 1: | NP_609451.1 | Gene: | CG6495 / 34486 | FlyBaseID: | FBgn0027550 | Length: | 675 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001104693.1 | Gene: | spint1b / 797346 | ZFINID: | ZDB-GENE-071218-1 | Length: | 499 | Species: | Danio rerio |
Alignment Length: | 306 | Identity: | 68/306 - (22%) |
---|---|---|---|
Similarity: | 102/306 - (33%) | Gaps: | 108/306 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 50 HFDVHKNTIIRTGESQAIGGKYLQGIELDTIEECERLCCETDACDVYIFERKAG-GYCYLFECGP 113
Fly 114 PEDFRCKFTRHANYTSAVLN--------------PQPKPVG----ELVTTPRPQLPHIPSNNVS- 159
Fly 160 ------QQEWELS--NLKL---KPEARD--------------KPTVSTAA---------VVAPTS 190
Fly 191 G-------TGTGTG----------------------VGLGVGQSPVYQSQS-------------- 212
Fly 213 -----VP----AAHCGRFQFTCHSGECIAVYNACDGIPQCEDGSDE 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6495 | NP_609451.1 | MANEC | 47..129 | CDD:284837 | 22/79 (28%) |
LDLa | 218..249 | CDD:238060 | 14/30 (47%) | ||
spint1b | NP_001104693.1 | MANEC | 31..116 | CDD:284837 | 22/79 (28%) |
PKD | 148..225 | CDD:214510 | 16/78 (21%) | ||
Kunitz_BPTI | 235..285 | CDD:278443 | 7/49 (14%) | ||
LDLa | 308..342 | CDD:238060 | 16/32 (50%) | ||
Kunitz_BPTI | 363..413 | CDD:278443 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 44 | 1.000 | Domainoid score | I12286 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |