DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6495 and spint1b

DIOPT Version :9

Sequence 1:NP_609451.1 Gene:CG6495 / 34486 FlyBaseID:FBgn0027550 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_001104693.1 Gene:spint1b / 797346 ZFINID:ZDB-GENE-071218-1 Length:499 Species:Danio rerio


Alignment Length:306 Identity:68/306 - (22%)
Similarity:102/306 - (33%) Gaps:108/306 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 HFDVHKNTIIRTGESQAIGGKYLQGIELDTIEECERLCCETDACDVYIFERKAG-GYCYLFECGP 113
            |....:|.::.|.||...|..:|....:...:.|...||:...|::.:.|.:|. ..|:||.|..
Zfish    36 HHPGRENFVLHTEESIEAGAVFLANPSVAHEDACMAACCKDARCNLALVENQASDNNCFLFNCLY 100

  Fly   114 PEDFRCKFTRHANYTSAVLN--------------PQPKPVG----ELVTTPRPQLPHIPSNNVS- 159
            ...|.||||....:|:.:|:              ....|:.    ::|..|...:  :.:.|.| 
Zfish   101 KHRFVCKFTPKQGFTNYILSSVYEKYLSGRKSEGKDSPPIANAGRDVVVQPNEDV--LLNGNESW 163

  Fly   160 ------QQEWELS--NLKL---KPEARD--------------KPTVSTAA---------VVAPTS 190
                  ..||.|:  |..:   |...||              |.||:.:|         |:..||
Zfish   164 DDKEIVNYEWSLTRGNKSVHMEKTNFRDQIRVSNLIPGVYEFKLTVTDSADQSDSAQVIVLVLTS 228

  Fly   191 G-------TGTGTG----------------------VGLGVGQSPVYQSQS-------------- 212
            .       |...||                      .|..:..|..|.|::              
Zfish   229 EQSERHCLTPKKTGPCRASFIRWNYNAASRRCEQFIFGGCMENSNNYLSETECQNACENTTVRAG 293

  Fly   213 -----VP----AAHCGRFQFTCHSGECIAVYNACDGIPQCEDGSDE 249
                 ||    ::.||...|.|.||.|:.....|||..:|.|||||
Zfish   294 GVTRKVPVEDCSSPCGVDSFKCSSGCCVKKEFECDGHQECSDGSDE 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6495NP_609451.1 MANEC 47..129 CDD:284837 22/79 (28%)
LDLa 218..249 CDD:238060 14/30 (47%)
spint1bNP_001104693.1 MANEC 31..116 CDD:284837 22/79 (28%)
PKD 148..225 CDD:214510 16/78 (21%)
Kunitz_BPTI 235..285 CDD:278443 7/49 (14%)
LDLa 308..342 CDD:238060 16/32 (50%)
Kunitz_BPTI 363..413 CDD:278443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12286
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.