DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6495 and SPINT1

DIOPT Version :9

Sequence 1:NP_609451.1 Gene:CG6495 / 34486 FlyBaseID:FBgn0027550 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_001373802.1 Gene:SPINT1 / 6692 HGNCID:11246 Length:529 Species:Homo sapiens


Alignment Length:306 Identity:65/306 - (21%)
Similarity:89/306 - (29%) Gaps:115/306 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IIRTGESQAIGGKYLQGIELDTIEECERLCCETDACDVYIFE------RKAGGYCYLFECGPPED 116
            ::.|..|.:.|..:|:...:....:|.|.||.|..|::.:.|      ..|...|:|..|...::
Human    62 VLDTNASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLINCLYEQN 126

  Fly   117 FRCKF----------TRHANYTSAVLNPQ-------PKPVGELVTTPRPQLPHIPSNNVSQQEW- 163
            |.|||          ||....:...|..|       ||....:....:||.| :...:|...:| 
Human   127 FVCKFAPREGFINYLTREVYRSYRQLRTQGFGGSGIPKAWAGIDLKVQPQEP-LVLKDVENTDWR 190

  Fly   164 ------------------ELSNLK-------LKPEARDKP--TVSTAAVVAPTSGTG----TGTG 197
                              ||..||       |...:.|.|  |.:....|..|..|.    ....
Human   191 LLRGDTDVRVERKDPNQVELWGLKEGTYLFQLTVTSSDHPEDTANVTVTVLSTKQTEDYCLASNK 255

  Fly   198 VGLGVGQSP--------------VY---------------------------------------Q 209
            ||...|..|              ||                                       |
Human   256 VGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECILACRGVQGGPLRGSSGAQATFPQ 320

  Fly   210 SQSVPAAH------CGRFQFTCHSGECIAVYNACDGIPQCEDGSDE 249
            ..|:...|      |...||.|.:|.||..:..||..|.|.|.|||
Human   321 GPSMERRHPVCSGTCQPTQFRCSNGCCIDSFLECDDTPNCPDASDE 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6495NP_609451.1 MANEC 47..129 CDD:284837 21/86 (24%)
LDLa 218..249 CDD:238060 13/30 (43%)
SPINT1NP_001373802.1 MANEC 50..139 CDD:400058 19/76 (25%)
Kunitz_BPTI 249..301 CDD:394972 6/51 (12%)
LDLa 334..366 CDD:197566 13/31 (42%)
Kunitz_BPTI 391..442 CDD:394972
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.