DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6495 and Y34D9A.8

DIOPT Version :9

Sequence 1:NP_609451.1 Gene:CG6495 / 34486 FlyBaseID:FBgn0027550 Length:675 Species:Drosophila melanogaster
Sequence 2:NP_001367694.1 Gene:Y34D9A.8 / 189589 WormBaseID:WBGene00021333 Length:178 Species:Caenorhabditis elegans


Alignment Length:98 Identity:32/98 - (32%)
Similarity:44/98 - (44%) Gaps:26/98 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 VGQSPVYQSQSVPAAHCGR-FQFTCHSGECIAVYNACDGIPQCEDGSDE--------GP------ 251
            :.|.||     :|  .|.| :::.|.:|||||.|:.||||.||.|||||        .|      
 Worm    27 LAQRPV-----LP--QCPREWEWACRNGECIAHYDVCDGITQCTDGSDEWNCEARGGAPMAREGV 84

  Fly   252 ----ECNIVLSTATKPATTSSNLEPVKPMVSQY 280
                :.|:..:.|....||:...|....:..||
 Worm    85 AQPRQTNVQATVAAVKETTTITAESSGTVTIQY 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6495NP_609451.1 MANEC 47..129 CDD:284837
LDLa 218..249 CDD:238060 18/31 (58%)
Y34D9A.8NP_001367694.1 LDLa 41..71 CDD:238060 18/29 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005567
OrthoInspector 1 1.000 - - oto17713
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.