DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17124 and PPP1R14C

DIOPT Version :9

Sequence 1:NP_001285813.1 Gene:CG17124 / 34485 FlyBaseID:FBgn0032297 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_112211.1 Gene:PPP1R14C / 81706 HGNCID:14952 Length:165 Species:Homo sapiens


Alignment Length:96 Identity:32/96 - (33%)
Similarity:55/96 - (57%) Gaps:11/96 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KERREK--FLTAKYGSHQMSLIRKRLAVEMWLYDELQKLFDPPNE---AIDVDIDEILDMDTDDI 91
            ::||.:  .:|.||...:   :||||.:|.|:.::|.:|:....|   .:::|||::||.|:|:.
Human    63 QQRRHQQGKVTVKYDRKE---LRKRLVLEEWIVEQLGQLYGCEEEEMPEVEIDIDDLLDADSDEE 124

  Fly    92 RRSHLIRLLSVCKRPQSDISKFIGDLLDRAK 122
            |.|.|...|..|.:|..:   ||.:||.|.:
Human   125 RASKLQEALVDCYKPTEE---FIKELLSRIR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17124NP_001285813.1 PP1_inhibitor 9..124 CDD:398826 32/96 (33%)
PPP1R14CNP_112211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..73 2/9 (22%)
PP1_inhibitor <71..165 CDD:283108 30/88 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147614
Domainoid 1 1.000 61 1.000 Domainoid score I10471
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1492626at2759
OrthoFinder 1 1.000 - - FOG0000782
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.