DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17124 and Ppp1r14d

DIOPT Version :9

Sequence 1:NP_001285813.1 Gene:CG17124 / 34485 FlyBaseID:FBgn0032297 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001277725.1 Gene:Ppp1r14d / 72112 MGIID:1919362 Length:175 Species:Mus musculus


Alignment Length:39 Identity:13/39 - (33%)
Similarity:22/39 - (56%) Gaps:5/39 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KERREKFLTAKYG-SHQMSLIRKRLAVEMWLYDELQKLF 69
            :.||...||.||. .|    :::.|.:|.|:..::|:||
Mouse    51 RSRRPSRLTVKYDRGH----LQRWLEMEQWVDAQVQELF 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17124NP_001285813.1 PP1_inhibitor 9..124 CDD:398826 13/39 (33%)
Ppp1r14dNP_001277725.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..57 2/5 (40%)
Interaction with protein phosphatase 1. /evidence=ECO:0000250 21..25
PP1_inhibitor <53..>85 CDD:283108 11/35 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837692
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5392
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000782
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.950

Return to query results.
Submit another query.