powered by:
Protein Alignment CG17124 and Ppp1r14d
DIOPT Version :9
Sequence 1: | NP_001285813.1 |
Gene: | CG17124 / 34485 |
FlyBaseID: | FBgn0032297 |
Length: | 124 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001277725.1 |
Gene: | Ppp1r14d / 72112 |
MGIID: | 1919362 |
Length: | 175 |
Species: | Mus musculus |
Alignment Length: | 39 |
Identity: | 13/39 - (33%) |
Similarity: | 22/39 - (56%) |
Gaps: | 5/39 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 KERREKFLTAKYG-SHQMSLIRKRLAVEMWLYDELQKLF 69
:.||...||.||. .| :::.|.:|.|:..::|:||
Mouse 51 RSRRPSRLTVKYDRGH----LQRWLEMEQWVDAQVQELF 85
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167837692 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
61 |
1.000 |
Inparanoid score |
I5392 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000782 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR16188 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
7 | 6.950 |
|
Return to query results.
Submit another query.