| Sequence 1: | NP_609450.1 | Gene: | CG17124 / 34485 | FlyBaseID: | FBgn0032297 | Length: | 124 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001277725.1 | Gene: | Ppp1r14d / 72112 | MGIID: | 1919362 | Length: | 175 | Species: | Mus musculus |
| Alignment Length: | 39 | Identity: | 13/39 - (33%) |
|---|---|---|---|
| Similarity: | 22/39 - (56%) | Gaps: | 5/39 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 32 KERREKFLTAKYG-SHQMSLIRKRLAVEMWLYDELQKLF 69 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17124 | NP_609450.1 | PP1_inhibitor | 9..124 | CDD:461630 | 13/39 (33%) |
| Ppp1r14d | NP_001277725.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..57 | 2/5 (40%) | |
| Interaction with protein phosphatase 1. /evidence=ECO:0000250 | 21..25 | ||||
| PP1_inhibitor | 53..>85 | CDD:461630 | 11/35 (31%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||