DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17124 and Ppp1r14d

DIOPT Version :10

Sequence 1:NP_609450.1 Gene:CG17124 / 34485 FlyBaseID:FBgn0032297 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001277725.1 Gene:Ppp1r14d / 72112 MGIID:1919362 Length:175 Species:Mus musculus


Alignment Length:39 Identity:13/39 - (33%)
Similarity:22/39 - (56%) Gaps:5/39 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KERREKFLTAKYG-SHQMSLIRKRLAVEMWLYDELQKLF 69
            :.||...||.||. .|    :::.|.:|.|:..::|:||
Mouse    51 RSRRPSRLTVKYDRGH----LQRWLEMEQWVDAQVQELF 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17124NP_609450.1 PP1_inhibitor 9..124 CDD:461630 13/39 (33%)
Ppp1r14dNP_001277725.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..57 2/5 (40%)
Interaction with protein phosphatase 1. /evidence=ECO:0000250 21..25
PP1_inhibitor 53..>85 CDD:461630 11/35 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.