DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17124 and ppp1r14ba

DIOPT Version :9

Sequence 1:NP_001285813.1 Gene:CG17124 / 34485 FlyBaseID:FBgn0032297 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001039318.1 Gene:ppp1r14ba / 564838 ZFINID:ZDB-GENE-060825-331 Length:130 Species:Danio rerio


Alignment Length:116 Identity:33/116 - (28%)
Similarity:63/116 - (54%) Gaps:14/116 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SPNRT-NLRVNFNEKGAEVKE--RREKFLTAKYGSHQMSLIRKRLAVEMWLYDELQKLFDPPNEA 75
            ||..| ..||.|.......:|  :::..:|.||...:   :|:||.:|.|:..:|..|:|...:.
Zfish     6 SPETTPQPRVYFQTPPGTEEEVPQKQGRVTVKYDRKE---LRRRLNLEEWIVSQLMNLYDCEEDE 67

  Fly    76 I---DVDIDEILDMDTDDIRRSHLIRLLSV-CKRPQSDISKFIGDLLDRAK 122
            :   ::|:||:||:.: |:.|:..:::|.| |.:|..|   |:..||::.:
Zfish    68 VPELEIDVDELLDLPS-DVERAIRVKMLLVDCYKPNDD---FVAALLEKVR 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17124NP_001285813.1 PP1_inhibitor 9..124 CDD:398826 33/116 (28%)
ppp1r14baNP_001039318.1 PP1_inhibitor 17..126 CDD:283108 28/105 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581420
Domainoid 1 1.000 61 1.000 Domainoid score I10414
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5380
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1492626at2759
OrthoFinder 1 1.000 - - FOG0000782
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.