DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17124 and ppp1r14aa

DIOPT Version :9

Sequence 1:NP_001285813.1 Gene:CG17124 / 34485 FlyBaseID:FBgn0032297 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001017863.1 Gene:ppp1r14aa / 550561 ZFINID:ZDB-GENE-050417-413 Length:152 Species:Danio rerio


Alignment Length:116 Identity:38/116 - (32%)
Similarity:56/116 - (48%) Gaps:27/116 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DCERSPNRTNLRVNFNEKGAEVKERREKFLTAKYGSHQMSLIRKRLAVEMWLYDELQKLF----- 69
            ||.|            |.|..:.:|..: :|.||...|   ::|||.||.|:.:.|.||:     
Zfish    14 DCAR------------EHGMNLHKRHSR-VTVKYNRKQ---LQKRLDVEKWIDEALDKLYEGKVE 62

  Fly    70 DPPNEAIDVDIDEILDMDTDDIRRSHLIRLLSVCKRPQSDISKFIGDLLDR 120
            |.|.|   |:||::||:.:|:.|...|..||..|   .|:...||.:||.:
Zfish    63 DMPEE---VNIDDLLDLPSDEARTHRLQALLQSC---SSNTEAFIAELLQK 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17124NP_001285813.1 PP1_inhibitor 9..124 CDD:398826 38/116 (33%)
ppp1r14aaNP_001017863.1 PP1_inhibitor 9..131 CDD:283108 38/116 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581419
Domainoid 1 1.000 61 1.000 Domainoid score I10414
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5380
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1492626at2759
OrthoFinder 1 1.000 - - FOG0000782
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16188
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5503
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.990

Return to query results.
Submit another query.