DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17124 and ppp1r14b

DIOPT Version :9

Sequence 1:NP_001285813.1 Gene:CG17124 / 34485 FlyBaseID:FBgn0032297 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001016307.1 Gene:ppp1r14b / 549061 XenbaseID:XB-GENE-485314 Length:129 Species:Xenopus tropicalis


Alignment Length:113 Identity:43/113 - (38%)
Similarity:63/113 - (55%) Gaps:12/113 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SPNRTNLRVNFNEKG--AEVKERREK-FLTAKYGSHQMSLIRKRLAVEMWLYDELQKLFDPPNEA 75
            ||:.|:.||.|...|  ||..|||.: .:|.||...:   :||||.:|.|:.::|..|:|...|.
 Frog    10 SPHPTSPRVYFQAPGETAEEPERRHQGKVTVKYDRKE---LRKRLRLEEWILEQLVVLYDCQEEE 71

  Fly    76 I---DVDIDEILDMDTDDIRRSHLIRLLSVCKRPQSDISKFIGDLLDR 120
            |   ::|:||:|||:||..|...:..||..|.:|   ...||..||::
 Frog    72 IPELEIDVDELLDMETDAQRGERVKELLVDCYKP---TEAFISGLLEK 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17124NP_001285813.1 PP1_inhibitor 9..124 CDD:398826 43/113 (38%)
ppp1r14bNP_001016307.1 PP1_inhibitor <33..129 CDD:368404 32/90 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11253
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5202
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1492626at2759
OrthoFinder 1 1.000 - - FOG0000782
OrthoInspector 1 1.000 - - oto104945
Panther 1 1.100 - - O PTHR16188
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.