DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17124 and PPP1R14D

DIOPT Version :10

Sequence 1:NP_609450.1 Gene:CG17124 / 34485 FlyBaseID:FBgn0032297 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001123615.1 Gene:PPP1R14D / 54866 HGNCID:14953 Length:200 Species:Homo sapiens


Alignment Length:38 Identity:13/38 - (34%)
Similarity:22/38 - (57%) Gaps:3/38 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KERREKFLTAKYGSHQMSLIRKRLAVEMWLYDELQKLF 69
            :.||...||.||...|   :::.|.:|.|:..::|:||
Human    50 RSRRPSRLTVKYDRGQ---LQRWLEMEQWVDAQVQELF 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17124NP_609450.1 PP1_inhibitor 9..124 CDD:461630 13/38 (34%)
PPP1R14DNP_001123615.1 PP1_inhibitor 28..>84 CDD:461630 11/36 (31%)

Return to query results.
Submit another query.