DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17124 and ppp1r14a

DIOPT Version :9

Sequence 1:NP_001285813.1 Gene:CG17124 / 34485 FlyBaseID:FBgn0032297 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001007956.1 Gene:ppp1r14a / 493331 XenbaseID:XB-GENE-489487 Length:138 Species:Xenopus tropicalis


Alignment Length:118 Identity:37/118 - (31%)
Similarity:66/118 - (55%) Gaps:15/118 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ERSPNRTNLRVNFNEKGAEVKERREKFLTAKYGSHQMSLIRKRLAVEMWLYDELQKLF-----DP 71
            :|.||:.:......:....: :||:..:|.||...:   ::|||.||.|:.:::::|:     |.
 Frog     8 KRFPNKPHSPSKTRDSNQGI-QRRQARVTVKYDRKE---LQKRLDVEKWIDEQMEELYLGREVDM 68

  Fly    72 PNEAIDVDIDEILDMDTDDIRRSHLIRLLSVCKRPQSDISKFIGDLLDRAKTL 124
            |:|   |:||::||::||:.||..|..:|..|   .::...||.:||.|.|.|
 Frog    69 PDE---VNIDDLLDLETDEDRRQSLQVILKSC---TNNTEAFIRELLLRLKGL 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17124NP_001285813.1 PP1_inhibitor 9..124 CDD:398826 36/116 (31%)
ppp1r14aNP_001007956.1 PP1_inhibitor 1..137 CDD:368404 37/118 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11253
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5202
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1492626at2759
OrthoFinder 1 1.000 - - FOG0000782
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.